Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SCN5A Rabbit Polyclonal Antibody

SKU: orb329800

Description

SCN5A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SCN5A. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C-terminal region of Human SCN5A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human SCN5A
TargetSCN5A
Protein SequenceSynthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED
Molecular Weight227kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CDCD2 antibody, anti CMD1E antibody, anti CMPD2 antibody, anti HB1 antibody, anti HB2 antibody, anti HBBD antibody, anti HH1 antibody, anti ICCD antibody, anti IVF antibody, anti LQT3 antibody, anti Nav1.5 antibody, anti PFHB1 antibody, anti SSS1 antibody, anti VF1 antibody

Similar Products

  • SCN5A Rabbit Polyclonal Antibody [orb329799]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SCN5A Rabbit Polyclonal Antibody [orb329836]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SCN5A Antibody [orb684897]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Nav-pan Rabbit Polyclonal Antibody [orb214555]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • SCN5A Antibody (N-term) [orb165865]

    WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SCN5A Rabbit Polyclonal Antibody

Rabbit Anti-SCN5A Antibody, Catalog Number: orb329800, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

SCN5A Rabbit Polyclonal Antibody

WB Suggested Anti-SCN5A Antibody Titration: HEK cel lysate; HEK cel with HuNav1.5 transfected lysate; Mouse Heart lysate 80 ug protein on gel QC Antibodies 1:100 in PBS/Tween secondary antibodie 1:10000 (IRDYE 800 CWGoat anti Rabbit IgG) analyse with the Licor Odyssey, Positive Control: HEK cel lysate; HEK cel with HuNav1.5 transfected lysate; Mouse Heart lysate 80 ug protein on gel QC Antibodies 1:100 in PBS/Tween secondary antibodie 1:10000 (IRDYE 800 CWGoat anti Rabbit IgG) analyse with the Licor Odyssey.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000326

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SCN5A Rabbit Polyclonal Antibody (orb329800)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry