You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329800 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SCN5A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SCN5A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 227kDa |
Target | SCN5A |
UniProt ID | Q14524 |
Protein Sequence | Synthetic peptide located within the following region: VMSENFSRPLGPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSED |
NCBI | NP_000326 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CDCD2 antibody, anti CMD1E antibody, anti CMP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-SCN5A Antibody, Catalog Number: orb329800, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.
WB Suggested Anti-SCN5A Antibody Titration: HEK cel lysate; HEK cel with HuNav1.5 transfected lysate; Mouse Heart lysate 80 ug protein on gel QC Antibodies 1:100 in PBS/Tween secondary antibodie 1:10000 (IRDYE 800 CWGoat anti Rabbit IgG) analyse with the Licor Odyssey, Positive Control: HEK cel lysate; HEK cel with HuNav1.5 transfected lysate; Mouse Heart lysate 80 ug protein on gel QC Antibodies 1:100 in PBS/Tween secondary antibodie 1:10000 (IRDYE 800 CWGoat anti Rabbit IgG) analyse with the Licor Odyssey.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P | |
Canine, Equine, Gallus, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |