You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592932 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RUNX1 |
Target | RUNX1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RUNX1 |
Protein Sequence | Synthetic peptide located within the following region: ASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT |
UniProt ID | B2RMS4 |
MW | 52kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AM Read more... |
Note | For research use only |
NCBI | NP_001745 |
WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:7812500, Positive Control: Human Small Intestine.
FC, WB | |
Bovine, Canine, Equine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |