RUNX1 Rabbit Polyclonal Antibody

• Catalog Number: orb592889
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RUNX1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RUNX1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49 kDa
• Target: RUNX1
• UniProt ID: B2RMS4
• Protein Sequence: Synthetic peptide located within the following region: ASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
• NCBI: NP_001745
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AM
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Mouse embryonic d13 spinal motor neurons, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti rabbit IgG Alexa 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: RUNX1: Red LSL1: Green, Gene Name: RUNX1.

WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: SH-SYSY cell lysate.

WB Suggested Anti-RUNX1 Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Human LCL and mouse brains.