Cart summary

You have no items in your shopping cart.

RUNX1 Rabbit Polyclonal Antibody

SKU: orb592889

Description

Rabbit polyclonal antibody to RUNX1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RUNX1
TargetRUNX1
Protein SequenceSynthetic peptide located within the following region: ASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
Molecular Weight49 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AML1-EVI-1, PEBP2alpha

Similar Products

  • RUNX1 Rabbit Polyclonal Antibody [orb6903]

    FC,  WB

    Bovine, Canine, Equine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • RUNX1/AML1 Rabbit Polyclonal Antibody [orb215911]

    IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RUNX1 rabbit pAb Antibody [orb770712]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • RUNX1 (phospho Ser249) rabbit pAb Antibody [orb770708]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • RUNX1 / AML1 + RUNX3 + RUNX2 Rabbit Polyclonal Antibody [orb500280]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RUNX1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

RUNX1 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

RUNX1 Rabbit Polyclonal Antibody

Sample Type: Mouse embryonic d13 spinal motor neurons, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti rabbit IgG Alexa 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: RUNX1: Red LSL1: Green, Gene Name: RUNX1.

RUNX1 Rabbit Polyclonal Antibody

WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: SH-SYSY cell lysate.

RUNX1 Rabbit Polyclonal Antibody

WB Suggested Anti-RUNX1 Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Human LCL and mouse brains.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001745

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RUNX1 Rabbit Polyclonal Antibody (orb592889)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry