Cart summary

You have no items in your shopping cart.

RUNX1 Rabbit Polyclonal Antibody

SKU: orb592889

Description

Rabbit polyclonal antibody to RUNX1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RUNX1
TargetRUNX1
Protein SequenceSynthetic peptide located within the following region: ASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
Molecular Weight49 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AML1-EVI-1, PEBP2alpha

Similar Products

  • RUNX1 Rabbit Polyclonal Antibody [orb6903]

    FC,  WB

    Bovine, Canine, Equine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • RUNX1/AML1 Rabbit Polyclonal Antibody [orb215911]

    IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RUNX1 (phospho Ser276) rabbit pAb Antibody [orb770710]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • RUNX1 rabbit pAb Antibody [orb770712]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • RUNX1 (phospho Ser249) rabbit pAb Antibody [orb770708]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RUNX1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

RUNX1 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

RUNX1 Rabbit Polyclonal Antibody

Sample Type: Mouse embryonic d13 spinal motor neurons, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti rabbit IgG Alexa 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: RUNX1: Red LSL1: Green, Gene Name: RUNX1.

RUNX1 Rabbit Polyclonal Antibody

WB Suggested Anti-RUNX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: SH-SYSY cell lysate.

RUNX1 Rabbit Polyclonal Antibody

WB Suggested Anti-RUNX1 Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Human LCL and mouse brains.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001745

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RUNX1 Rabbit Polyclonal Antibody (orb592889)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry