You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb585936 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RPL11 |
| Target | RPL11 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL11 |
| Protein Sequence | Synthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK |
| UniProt ID | P62913 |
| MW | 20kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | L11, uL5, DBA7, GIG34 |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_001186731 |

Rabbit Anti-RPL11 Antibody, Catalog Number: orb585936, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RPL11 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. RPL11 is supported by BioGPS gene expression data to be expressed in HeLa.
ELISA, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, WB | |
Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review