Cart summary

You have no items in your shopping cart.

RPL11 Rabbit Polyclonal Antibody (FITC)

RPL11 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2092614

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2092614
CategoryAntibodies
DescriptionRPL11 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL11
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW20kDa
UniProt IDP62913
Protein SequenceSynthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK
NCBINP_001186731
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesL11, uL5, DBA7, GIG34
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.