Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RPE Rabbit Polyclonal Antibody

SKU: orb326116

Description

RPE Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RPE. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human RPE. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RPE
TargetRPE
Protein SequenceSynthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ
Molecular Weight19kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MGC2636 antibody, anti RPE2-1 antibody

Similar Products

  • HSP70 Antibody (RPE) [orb151246]

    ELISA,  FC,  ICC,  IF,  IHC,  IP,  WB

    Bovine, Canine, Fish, Guinea pig, Hamster, Human, Mammal, Monkey, Mouse, Other, Plant, Porcine, Rat, Sheep

    Rabbit

    Polyclonal

    RPE

    100 μg
  • Amyloid Fibrils (OC) Antibody (RPE) [orb152875]

    DOT,  ELISA,  ICC,  IF,  IHC,  IP,  WB

    Human

    Rabbit

    Polyclonal

    RPE

    100 μl
  • Erk1/2 Antibody (RPE) [orb151501]

    FC,  ICC,  IF,  IHC,  WB

    Bovine, Drosophila, Frog, Gallus, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    RPE

    100 μl
  • TNF-R1 Antibody (RPE) [orb151867]

    ICC,  IF,  IHC,  IP,  WB

    Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    RPE

    100 μg
  • TLR4 Antibody (RPE) [orb152207]

    FACS,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    RPE

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RPE Rabbit Polyclonal Antibody

Rabbit Anti-RPE Antibody, Catalog Number: orb326116, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

RPE Rabbit Polyclonal Antibody

WB Suggested Anti-RPE Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: ACHN cell lysate, RPE is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_008847

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RPE Rabbit Polyclonal Antibody (orb326116)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry