RNASEH2A Rabbit Polyclonal Antibody

• Catalog Number: orb324883
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RNASEH2A
• Target: RNASEH2A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASEH2A
• Protein Sequence: Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE
• UniProt ID: O75792
• MW: 33 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AGS4 antibody, anti JUNB antibody, anti RNHL
• Research Area: Cell Biology, Molecular Biology
• Note: For research use only
• NCBI: NP_006388
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.

Rabbit Anti-RNASEH2A Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-RNASEH2A Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, RNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat.