You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324882 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RNASEH2A |
Target | RNASEH2A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEH2A |
Protein Sequence | Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES |
UniProt ID | O75792 |
MW | 33kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti JUNB antibody, anti RNASEHI antibody, anti RN Read more... |
Note | For research use only |
NCBI | NP_006388 |
Rabbit Anti-RNASEH2A Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-RNASEH2A Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, RNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat.
IHC, WB | |
Bovine, Canine, Equine, Goat, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
IHC, WB | |
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |