You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb324882 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RNASEH2A |
| Target | RNASEH2A |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEH2A |
| Protein Sequence | Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES |
| UniProt ID | O75792 |
| MW | 33kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti JUNB antibody, anti RNASEHI antibody, anti RN Read more... |
| Research Area | Cell Biology, Molecular Biology |
| Note | For research use only |
| NCBI | NP_006388 |
| Expiration Date | 12 months from date of receipt. |

Rabbit Anti-RNASEH2A Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-RNASEH2A Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, RNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat.
IHC, WB | |
Bovine, Canine, Equine, Goat, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
IHC, WB | |
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review