Cart summary

You have no items in your shopping cart.

RNASEH2A Rabbit Polyclonal Antibody (FITC)

RNASEH2A Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2125143

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2125143
CategoryAntibodies
DescriptionRNASEH2A Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human RNASEH2A
Protein SequenceSynthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES
UniProt IDO75792
MW33kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesAGS4, JUNB, RNHL, RNHIA, THSD8, RNASEHI
NoteFor research use only
NCBINP_006388
Expiration Date12 months from date of receipt.
Images
Similar Products
  • RNASEH2A Rabbit Polyclonal Antibody (FITC) [orb2125140]

    IHC,  WB

    Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
Reviews

RNASEH2A Rabbit Polyclonal Antibody (FITC) (orb2125143)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet