RLN1 Rabbit Polyclonal Antibody

SKU: orb327496

Description

RLN1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RLN1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human RLN1. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RLN1
• Target: RLN1
• Protein Sequence: Synthetic peptide located within the following region: RNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAK
• Molecular Weight: 21 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti H1 antibody, anti H1RLX antibody, anti RLXH1 antibody, anti bA12D24.3.1 antibody, anti bA12D24.3.2 antibody

Quick Database Links

Gene Symbol

RLN1

UniProt

P04808

RefSeq (Protein):NP_008842.1