RIOX2 Rabbit Polyclonal Antibody

• Catalog Number: orb577252
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RIOX2
• Target: RIOX2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MINA
• Protein Sequence: Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK
• UniProt ID: Q8IUF6
• MW: 32kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ROX, MDIG, MINA, NO52, JMJD10, MINA53
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_694822

Human kidney

Rabbit Anti-MINA Antibody, Catalog Number: orb577252, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue, Observed Staining: Cytoplasm in follicular cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MINA Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.