You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577252 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RIOX2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Equine, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MINA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | RIOX2 |
UniProt ID | Q8IUF6 |
Protein Sequence | Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK |
NCBI | NP_694822 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ROX, MDIG, MINA, NO52, JMJD10, MINA53 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
Rabbit Anti-MINA Antibody, Catalog Number: orb577252, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue, Observed Staining: Cytoplasm in follicular cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-MINA Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.
WB | |
Canine, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Equine, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |