RIOX2 Rabbit Polyclonal Antibody

• Catalog Number: orb577254
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RIOX2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MINA
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: RIOX2
• UniProt ID: Q96KB0
• Protein Sequence: Synthetic peptide located within the following region: HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQV
• NCBI: NP_116167
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ROX, MDIG, MINA, NO52, JMJD10, MINA53
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-MINA Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate. MINA is supported by BioGPS gene expression data to be expressed in Jurkat.