RIOX2 Rabbit Polyclonal Antibody

• Catalog Number: orb573553
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RIOX2
• Target: RIOX2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MINA
• Protein Sequence: Synthetic peptide located within the following region: LTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSH
• UniProt ID: Q8IUF8
• MW: 24kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ROX, MDIG, MINA, NO52, JMJD10, MINA53
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_694822

Sample Type: Breast Tumor lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-MINA antibody, Formalin Fixed Paraffin Embedded Tissue: Human Small Intestine, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-MINA antibody, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.