Reg1 Rabbit Polyclonal Antibody

SKU: orb585676

Description

Reg1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Reg1. It is suitable for WB and is reactive with human, mouse samples. Predicted reactivity includes Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Reg1
• Protein Sequence: Synthetic peptide located within the following region: LHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKD
• Molecular Weight: 18kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PSP, PTP

Quick Database Links

Gene Symbol

Reg1

UniProt

Q3TV26

RefSeq (Protein):NP_033068