You have no items in your shopping cart.
Cart summary
Recombinant Mouse VEGF-A
Catalog Number: orb623194
| Catalog Number | orb623194 |
|---|---|
| Category | Proteins |
| Description | VEGF-A is member of the family of vascular endothelial growth factor (VEGF) proteins, which stimulate vasculogenesis and angiogenesis to restore oxygen supply to tissues. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF). Mouse VEGF-A Recombinant Protein is purified vascular endothelial growth factor A produced in yeast. |
| Form/Appearance | Lyophilized |
| MW | 19.3 kDa |
| Protein Sequence | APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCC NDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCS ERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164) |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Application notes | The Mouse IL-2 protein can be used in cell culture, as an IL-2 ELISA Standard, and as a Western Blot Control. |
| Expiration Date | 6 months from date of receipt. |
Mouse VEGFA protein [orb392697]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
P. pastoris
50 μg, 500 μg, 10 μgMouse mVEGF (121a.a.) Protein [orb752980]
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Saccharomyces cerevisiae
100 μg, 1 mg, 250 μgMouse mVEGF Protein [orb752979]
Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Saccharomyces cerevisiae
1 mg, 100 μg, 250 μg
