You have no items in your shopping cart.
Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)
SKU: orb2986913
Active
Description
Research Area
Cancer Biology; Immunology & Inflammation; Cell Biology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Anti-LTBR recombinant antibody, the EC50 is 0.6450-0.8200 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind human TNFSF14, the EC50 is 4.399-5.172 ng/ml. |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 31-227aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 23.1 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD18; D12S370; LT beta R; LTBETAR; Ltbr; Lymphotoxin B receptor; Lymphotoxin beta receptor (TNFR superfamily; member 3); Lymphotoxin beta receptor; Lymphotoxin-beta receptor; TNF R III; TNF-RIII; TNFCR; TNFR RP; TNFR superfamily member 3; TNFR-III; TNFR2 RP; TNFR2RP; TNFR3; TNFRII; TNFRRP; TNFRSF 3; TNFRSF3; TNR3_HUMAN; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2 related protein; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor superfamily member 3; Tumor necrosis factor receptor superfamily member 3 precursor; Tumor necrosis factor receptor type III
Similar Products
−Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active) [orb2658317]
Greater than 95% as determined by SDS-PAGE.
23.2 kDa
Yeast
1 mg, 100 μg, 20 μgRecombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active) [orb2986414]
Greater than 95% as determined by SDS-PAGE.
50.7 kDa
Mammalian cell
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


