Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)

SKU: orb2986414

Description

This Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active) spans the amino acid sequence from region 31-227aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cell Biology

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Biotinylated human TNFSF14. The EC50 is 4.282-4.919 ng/mL.
• Tag: C-terminal hFc1-tagged
• Molecular Weight: 50.7 kDa
• Expression Region: 31-227aa
• Protein Length: Partial
• Protein Sequence: QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Disclaimer: For research use only

Alternative Names

Tumor necrosis factor receptor superfamily member 3; Lymphotoxin-beta receptor; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor type III (TNF-RIII; TNFR-III); LTBR; D12S370, TNFCR, TNFR3, TNFRSF3

Quick Database Links

UniProt

P36941