You have no items in your shopping cart.
Cart summary
Item 1 of 1
RASA4 Rabbit Polyclonal Antibody
Catalog Number: orb588751
| Catalog Number | orb588751 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RASA4 |
| Target | RASA4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RASA4 |
| Protein Sequence | Synthetic peptide located within the following region: EEGWFRLQPDQSKSRRHDEGNLGSLQLEVRLRDETVLPSSYYQPLVHLLC |
| UniProt ID | O43374 |
| MW | 88 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GAPL, CAPRI |
| Note | For research use only |
| NCBI | NP_001073346.2 |
Sample Tissue: Mesenchymoma lysates, Antibody Dilution: 1 ug/ml.
- Item 1 of 2
Anti-CAPRI Antibody [orb214965]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 2
RASA4 Rabbit Polyclonal Antibody [orb312873]
WB
Mouse
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
