Rab1a Antibody

SKU: orb653853

Description

Goat polyclonal antibody to Rab1a. This protein is a member of the Ras superfamily of GTPases. Members of this family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus.

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:1,000-1:2,000, IHC-P:1:100-1:500, IHC-F:1:100-1:500
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 107 aa to the C-terminus of Rab1a produced in E. coli. Antigen Sequence: QEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGA
• Target: RAB1, member RAS oncogene family
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Rab1, YPT1 antibody.

Quick Database Links

Gene Symbol

RAB1, member RAS oncogene family