Rab11b Antibody

SKU: orb180472

Description

Goat polyclonal antibody to mouse Rab11b. Rab11 belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and plays essential roles in vesicle and granule targeting. Similar to Rab11a, it has been shown that Rab11b associates with recycling endosomes.

Research Area

Cell Biology

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:250-1:2,000, IF:1:50-1:250, IHC-P:1:100-1:400, IHC-F:1:100-1:400
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab11b produced in E. coli. Antigen Sequence: MVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQRPNKLQCCQSL
• Target: RAB11b, member RAS oncogene family
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GTP-binding protein YPT3; member of RAS oncogene family; ras-related protein Rab-11B antibody.

Western blot analysis of HEK293 and At-T20 cell line lysate using Rab11b antibody.

Quick Database Links

Gene Symbol

RAB11b, member RAS oncogene family