You have no items in your shopping cart.
Cart summary
Primate IFN beta protein
Catalog Number: orb1215753
| Catalog Number | orb1215753 |
|---|---|
| Category | Proteins |
| Description | The Gibbon IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Gibbon IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Gibbon IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Gibbon IFN beta Specifications: (Molecular Weight: 20.1 kDa) (Amino Acid Sequence: MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166)) (Gene ID: 100598986). |
| Target | IFN beta |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166) |
| Protein Length | 166 |
| MW | 20.1 kDa |
| Source | Yeast |
| Biological Origin | Gibbon |
| Storage | -20°C |
| Note | For research use only |
Primate IL 6 Protein [orb429415]
Greater than 97.0% as determined by SDS-PAGE and HPLC analyses.
Escherichia Coli
0.1 mg, 2 μg, 10 μg
