Presenilin 2 loop region Antibody

SKU: orb3167666

Description

Our Anti-Presenilin 2 loop region rabbit polyclonal primary antibody detects human and mouse Presenilin 2 loop region, and is IgG. It is validated for use in ICC, WB.

Images & Validation

• Tested Applications: ICC, WB
• Dilution Range: WB: 1:1000; IP: 1:100
• Reactivity: Human, Mouse
• Application Notes:
  Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50 mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min.

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
• Target: Presenilin 2 loop region
• Molecular Weight: 22 kDa, 45 kDa (See application details.)
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Lyophilized
• Buffer/Preservatives: Lyophilized from PBS, pH 7.4. Contains no preservative.
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AD3LP, AD5, E5-1, STM-2

Quick Database Links

Gene Symbol

Presenilin 2 loop region

UniProt

P49810