Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Presenilin 2 loop region Antibody

SKU: orb3167666

Description

Our Anti-Presenilin 2 loop region rabbit polyclonal primary antibody detects human and mouse Presenilin 2 loop region, and is IgG. It is validated for use in ICC, WB.

Images & Validation

Tested ApplicationsICC, WB
Dilution RangeWB: 1:1000; IP: 1:100
ReactivityHuman, Mouse
Application Notes
Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50 mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min.

Key Properties

HostRabbit
ClonalityPolyclonal
IsotypeIgG
ImmunogenA synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
TargetPresenilin 2 loop region
Molecular Weight22 kDa, 45 kDa (See application details.)
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearanceLyophilized
Buffer/PreservativesLyophilized from PBS, pH 7.4. Contains no preservative.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AD3LP, AD5, E5-1, STM-2
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
ICC
Immunocytochemistry
View Protocol

Available Sizes

Select a size below

500 μg
$ 710.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 5-10 working days
Bulk Enquiry