Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PPP2CA Rabbit Polyclonal Antibody

SKU: orb327482

Description

Rabbit polyclonal antibody to PP2AB

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityHuman

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PPP2CA
TargetPPP2CA
Protein SequenceSynthetic peptide located within the following region: SIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQ
Molecular Weight36 kDa
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti RP-C antibody, anti PP2Ac antibody, anti PP2CA antibody, anti PP2Calpha antibody

Similar Products

  • PP2A alpha + beta Rabbit Polyclonal Antibody [orb11287]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PP2A-alpha/PPP2CA/PP2A Rabbit Polyclonal Antibody [orb251530]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Phospho-PP2A alpha+beta (Tyr307) Rabbit Polyclonal Antibody [orb2300]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PP2A alpha + beta Rabbit Polyclonal Antibody [orb101330]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPP2CA Rabbit Polyclonal Antibody [orb585511]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PPP2CA Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

PPP2CA Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1.0 ug/mL.

PPP2CA Rabbit Polyclonal Antibody

PPP2CA was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb327482 with 1:200 dilution. Western blot was performed using orb327482 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: PPP2CA IP with orb327482 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PPP2CA Rabbit Polyclonal Antibody (orb327482)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry