PPP1R3C Rabbit Polyclonal Antibody

SKU: orb585461

Description

Rabbit polyclonal antibody to PPP1R3C

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Porcine, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: PPP1R3C
• Protein Sequence: Synthetic peptide located within the following region: PPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKK
• Molecular Weight: 35kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PTG, PPP1R5

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Lanes: 1: 1 ug insoluble STUB1 protein, 2: 1 ug soluble STUB1 protein, 3: 1 ug EPM2A protein, 4: 1 ug insoluble PPP1R3C protein, 5: 1 ug soluble PPP1R3C protein, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-AP, Secondary Antibody dilution: 1:20000, Gene Name: PPP1R3C.

WB Suggested Anti-PPP1R3C Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell.

Quick Database Links

Gene Symbol

PPP1R3C

UniProt

Q9UQK1

RefSeq (Protein):NP_005389