You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Porcine, Rabbit |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | PPP1R3C |
| Protein Sequence | Synthetic peptide located within the following region: PPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKK |
| Molecular Weight | 35kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PPP1R3C Rabbit Polyclonal Antibody [orb155240]
ELISA, IHC, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μgPPP1R3C Rabbit Polyclonal Antibody [orb3069303]
IF, IHC, WB
Human, Monkey
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Lanes: 1: 1 ug insoluble STUB1 protein, 2: 1 ug soluble STUB1 protein, 3: 1 ug EPM2A protein, 4: 1 ug insoluble PPP1R3C protein, 5: 1 ug soluble PPP1R3C protein, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-AP, Secondary Antibody dilution: 1:20000, Gene Name: PPP1R3C.

WB Suggested Anti-PPP1R3C Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell.
Documents Download
Request a Document
PPP1R3C Rabbit Polyclonal Antibody (orb585461)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

