PPARD Rabbit Polyclonal Antibody

• Catalog Number: orb330015
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PPARD
• Target: PPARD
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human PPARD
• Protein Sequence: Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS
• UniProt ID: Q03181
• MW: 49kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FAAR antibody, anti MGC3931 antibody, anti NR
• Research Area: Epigenetics & Chromatin, Signal Transduction, Stem
• Note: For research use only
• NCBI: NP_001034783

Rabbit Anti-PPARD antibody, Catalog Number: orb330015, Paraffin Embedded Tissue: Human Placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PPARD Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, PPARD is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.