PPARD Rabbit Polyclonal Antibody

SKU: orb330016

Description

Rabbit polyclonal antibody to PPARD

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PPARD
• Target: PPARD
• Protein Sequence: Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
• Molecular Weight: 49kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FAAR antibody, anti NUC1 antibody, anti NUCI antibody, anti NR1C2 antibody, anti NUCII antibody, anti PPARB antibody

Rabbit Anti-PPARD antibody, Catalog Number: orb330016, Paraffin Embedded Tissue: Human Placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PPARD Antibody Titration: 0.625 ug/mL, ELISA Titer: 1:1562500, Positive Control: LN18 cell lysate, PPARD is strongly supported by BioGPS gene expression data to be expressed in Human LN18 cells.

Quick Database Links

Gene Symbol

PPARD

UniProt

Q03181

RefSeq (Protein):NP_006229