PPARD Rabbit Polyclonal Antibody

• Catalog Number: orb329944
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PPARD
• Target: PPARD
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD
• Protein Sequence: Synthetic peptide located within the following region: FGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTK
• UniProt ID: P35396
• MW: 48kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti NUC1 antibody, anti NUC-1 antibody, anti Nr1c
• Research Area: Epigenetics & Chromatin, Pharmacology & Drug Disco
• Note: For research use only
• NCBI: NP_035275

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-PPARD Antibody Titration: 0.3125 ug/mL, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.