PPARD Rabbit Polyclonal Antibody

SKU: orb329944

Description

Rabbit polyclonal antibody to PPARD

Research Area

Epigenetics & Chromatin, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD
• Target: PPARD
• Protein Sequence: Synthetic peptide located within the following region: FGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTK
• Molecular Weight: 48kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti NUC1 antibody, anti NUC-1 antibody, anti Nr1c2 antibody, anti Pparb antibody, anti PPAR[b] antibody, anti Pparb/d antibody, anti PPAR-beta antibody, anti PPARdelta antibody, anti PPAR-delta antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-PPARD Antibody Titration: 0.3125 ug/mL, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.

Quick Database Links

Gene Symbol

PPARD

UniProt

P35396

RefSeq (Protein):NP_035275