Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

POU2F3 Rabbit Polyclonal Antibody

SKU: orb329669

Description

Rabbit polyclonal antibody to POU2F3

Research Area

Epigenetics & Chromatin, Protein Biochemistry

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse, Rat
Predicted ReactivityCanine, Guinea pig, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
TargetPOU2F3
Protein SequenceSynthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
Molecular Weight47 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti PLA1 antibody, anti OCT11 antibody, anti PLA-1 antibody, anti Epoc-1 antibody, anti OCT-11 antibody, anti OTF-11 antibody, anti Skn-1a antibody

Similar Products

  • POU2F3 Rabbit Polyclonal Antibody [orb312655]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Human, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • POU2F3 Rabbit Polyclonal Antibody [orb329670]

    IHC,  WB

    Canine, Guinea pig, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • POU2F3 Rabbit Polyclonal Antibody (PE) [orb491741]

    IF

    Bovine, Canine, Human, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    PE

    100 μl
  • POU2F3 Rabbit Polyclonal Antibody [orb330952]

    WB

    Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • POU2F3 Rabbit Polyclonal Antibody [orb3068893]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

POU2F3 Rabbit Polyclonal Antibody

Human Muscle

POU2F3 Rabbit Polyclonal Antibody

25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. N-terminal peptide also overlaps with isoform 3 at 39 kDa in some samples.

POU2F3 Rabbit Polyclonal Antibody

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

POU2F3 Rabbit Polyclonal Antibody

Rabbit Anti-POU2F3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

POU2F3 Rabbit Polyclonal Antibody

Sample Type: Mouse tongue tissue, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: POU2F3, Gene Name: POU2F3.

POU2F3 Rabbit Polyclonal Antibody

WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_055167

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

POU2F3 Rabbit Polyclonal Antibody (orb329669)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry