POU2F3 Rabbit Polyclonal Antibody

SKU: orb329669

Description

POU2F3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of POU2F3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3. This antibody reacts with Human, Mouse, Rat samples and is predicted to react with Canine, Guinea pig, Rabbit, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Predicted Reactivity: Canine, Guinea pig, Rabbit, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
• Target: POU2F3
• Protein Sequence: Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
• Molecular Weight: 47 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti PLA1 antibody, anti OCT11 antibody, anti PLA-1 antibody, anti Epoc-1 antibody, anti OCT-11 antibody, anti OTF-11 antibody, anti Skn-1a antibody

Human Muscle

25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. N-terminal peptide also overlaps with isoform 3 at 39 kDa in some samples.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Rabbit Anti-POU2F3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Sample Type: Mouse tongue tissue, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: POU2F3, Gene Name: POU2F3.

WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

POU2F3

UniProt

Q9UKI9

RefSeq (Protein):NP_055167