POU2F3 Rabbit Polyclonal Antibody

• Catalog Number: orb329669
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POU2F3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Guinea pig, Rabbit, Sheep, Zebrafish
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47 kDa
• Target: POU2F3
• UniProt ID: Q9UKI9
• Protein Sequence: Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
• NCBI: NP_055167
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti PLA1 antibody, anti OCT11 antibody, anti PLA-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Muscle

25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. N-terminal peptide also overlaps with isoform 3 at 39 kDa in some samples.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Rabbit Anti-POU2F3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Sample Type: Mouse tongue tissue, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: POU2F3, Gene Name: POU2F3.

WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.