POU2F3 Rabbit Polyclonal Antibody

SKU: orb330952

Description

POU2F3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of POU2F3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3
• Target: POU2F3
• Protein Sequence: Synthetic peptide located within the following region: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN
• Molecular Weight: 24kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PLA1, OCT11, PLA-1, Epoc-1, OCT-11, OTF-11, Skn-1a

Sample Type: Fetal Kidney lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

POU2F3

UniProt

Q9UKI9

RefSeq (Protein):NP_001231611.1