POU2F3 Rabbit Polyclonal Antibody

SKU: orb329670

Description

POU2F3 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of POU2F3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3. This antibody reacts with Human, Mouse, Rat samples and is predicted to react with Canine, Guinea pig, Rabbit, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Predicted Reactivity: Canine, Guinea pig, Rabbit, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
• Target: POU2F3
• Protein Sequence: Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
• Molecular Weight: 47kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti PLA1 antibody, anti OCT11 antibody, anti PLA-1 antibody, anti Epoc-1 antibody, anti OCT-11 antibody, anti OTF-11 antibody, anti Skn-1a antibody

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Sample Type: Mouse tongue tissue, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: POU2F3, Gene Name: POU2F3.

WB Suggested Anti-POU2F3 Antibody, Titration: 1.25 ug/mL, Positive Control: HepG2 Whole Cell.

Quick Database Links

Gene Symbol

POU2F3

UniProt

Q9UKI9

RefSeq (Protein):NP_055167