Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

POLQ Rabbit Polyclonal Antibody

SKU: orb580669

Description

POLQ Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of POLQ. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human POLQ
TargetPOLQ
Protein SequenceSynthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL
Molecular Weight290 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PRO0327

Similar Products

  • DNA polymerase theta Rabbit Polyclonal Antibody [orb385434]

    ICC,  IF,  IHC-P,  WB

    Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HEL308 Antibody (Center) [orb1930656]

    FC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • DNA polymerase eta Rabbit pAb [orb48495]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • POLK Rabbit Polyclonal Antibody [orb156614]

    FC

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • POLK Rabbit Polyclonal Antibody [orb1816938]

    ELISA,  WB

    Bovine, Equine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

POLQ Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. Several high molecular weight isoforms contain this peptide sequence including 290 kDa, 198 kDa, and 129.

POLQ Rabbit Polyclonal Antibody

Sample Tissue: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

POLQ Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

POLQ Rabbit Polyclonal Antibody

Sample Tissue: Human Thyroid, Antibody dilution: 1.0 ug/ml.

POLQ Rabbit Polyclonal Antibody

Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

POLQ Rabbit Polyclonal Antibody

POLQ (polymerase (DNA directed), theta) Antibody (against the C terminal of POLQ) (50 ug) validated by WB using Placenta Lysate at 0.2-1 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

POLQ Rabbit Polyclonal Antibody (orb580669)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry