POLQ Rabbit Polyclonal Antibody

• Catalog Number: orb580669
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DNA Polymerase theta
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 290 kDa
• Target: POLQ
• UniProt ID: O75417
• Protein Sequence: Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL
• NCBI: NP_955452.3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PRO0327
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. Several high molecular weight isoforms contain this peptide sequence including 290 kDa, 198 kDa, and 129.

Sample Tissue: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Thyroid, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

POLQ (polymerase (DNA directed), theta) Antibody (against the C terminal of POLQ) (50 ug) validated by WB using Placenta Lysate at 0.2-1 ug/ml.