PLA2G7 Rabbit Polyclonal Antibody

• Catalog Number: orb588988
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PLA2G7
• Target: PLA2G7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLA2G7
• Protein Sequence: Synthetic peptide located within the following region: ILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLAS
• UniProt ID: Q13093
• MW: 50 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PAFAD, PAFAH, LP-PLA2, LDL-PLA2
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_001161829.1
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1.0 ug/ml.