You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| CAS Number | 118997-30-1 |
|---|---|
| MW | 4049.5 Da |
| Purity | > 95% by HPLC |
| Formula | C194H295N55O57 |
| Protein Sequence | H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
Storage & Handling
−| Storage | Store desiccated, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PYY (1-36), 118997-30-1GH110, H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, NPY, PYY, PYY (1-36), Peptide YY, YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, diabetes, food ingestion, gut motility, insulin secretion, neuropeptide Y, obesity
Similar Products
−- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 2
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days