You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325375 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to pb |
Target | pb |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Drosophila |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK |
UniProt ID | P31264 |
MW | 83kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti Dmel_CG31481 antibody, anti CG31481 antibody, Read more... |
Note | For research use only |
NCBI | NP_996163 |
WB Suggested Anti-pb Antibody Titration: 0.2-1 ug/mL, Positive Control: Drosophila.
IF, IH, WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |