Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PARK7 Rabbit Polyclonal Antibody

SKU: orb581327

Description

PARK7 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PARK7. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human PARK7. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PARK7
TargetPARK7
Protein SequenceSynthetic peptide located within the following region: TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
Molecular Weight20kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DJ1, DJ-1, GATD2, HEL-S-67p

Similar Products

  • PARK7/DJ1 Rabbit Polyclonal Antibody [orb10543]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PARK7/DJ1 Rabbit Polyclonal Antibody [orb402400]

    ELISA,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PARK7/DJ1 Rabbit Polyclonal Antibody [orb234354]

    ICC,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • DJ-1 rabbit pAb Antibody [orb765050]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • PARK7 rabbit pAb Antibody [orb766025]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PARK7 Rabbit Polyclonal Antibody

Sample Type: Mouse Brain Slices, Red: primary, Blue: DAPI, Primary dilution: 1:400, Secondary Antibody: Anti-Rabbit IgG Alexa 594, Secondary dilution: 1:400.

PARK7 Rabbit Polyclonal Antibody

PARK7 antibody - C-terminal region (orb581327) validated by WB using SH-SY5Y cell line at 1:500. PARK7 is supported by BioGPS gene expression data to be expressed in SHSY5Y.

PARK7 Rabbit Polyclonal Antibody

WB Suggested Anti-PARK7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_009193

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PARK7 Rabbit Polyclonal Antibody (orb581327)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry