PARK7 Rabbit Polyclonal Antibody

SKU: orb581327

Description

Rabbit polyclonal antibody to PARK7

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PARK7
• Target: PARK7
• Protein Sequence: Synthetic peptide located within the following region: TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
• Molecular Weight: 20kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DJ1, DJ-1, GATD2, HEL-S-67p

Sample Type: Mouse Brain Slices, Red: primary, Blue: DAPI, Primary dilution: 1:400, Secondary Antibody: Anti-Rabbit IgG Alexa 594, Secondary dilution: 1:400.

PARK7 antibody - C-terminal region (orb581327) validated by WB using SH-SY5Y cell line at 1:500. PARK7 is supported by BioGPS gene expression data to be expressed in SHSY5Y.

WB Suggested Anti-PARK7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

PARK7

UniProt

Q99497

RefSeq (Protein):NP_009193