You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331245 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PAG1 |
Target | PAG1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: PNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYE |
UniProt ID | Q9NWQ8 |
MW | 47kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CBP antibody, anti FLJ37858 antibody, anti MG Read more... |
Note | For research use only |
NCBI | NP_060910 |
WB Suggested Anti-PAG1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.
IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |