You have no items in your shopping cart.
Cart summary
Item 1 of 1
PAG1 Rabbit Polyclonal Antibody
Catalog Number: orb331245
| Catalog Number | orb331245 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PAG1 |
| Target | PAG1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: PNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYE |
| UniProt ID | Q9NWQ8 |
| MW | 47kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CBP antibody, anti FLJ37858 antibody, anti MG Read more... |
| Note | For research use only |
| NCBI | NP_060910 |
WB Suggested Anti-PAG1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.
- Item 1 of 1
- Item 1 of 2
PAG1 Rabbit Polyclonal Antibody [orb158091]
IF, IHC-Fr, IHC-P, WB
Canine, Equine, Human, Rabbit
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
