OVOL2 Rabbit Polyclonal Antibody

• Catalog Number: orb324802
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OVOL2
• Target: OVOL2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OVOL2
• Protein Sequence: Synthetic peptide located within the following region: QEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
• UniProt ID: Q9BRP0
• MW: 30kDa
• Tested applications: ICC, IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti EUROIMAGE566589 antibody, anti ZNF339 antibod
• Note: For research use only
• NCBI: NP_067043

Positive control (+): RPMI-8226 (N12), Negative control (-): U937 (N31), Antibody concentration: 2 ug/mL.

WB Suggested Anti-OVOL2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.