Ovol2 Rabbit Polyclonal Antibody

SKU: orb324464

Description

Ovol2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Ovol2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of MOUSE Ovol2. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Guinea pig, Human, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of MOUSE Ovol2
• Target: Ovol2
• Protein Sequence: Synthetic peptide located within the following region: HDAQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHNCDLCGKSFRLQRML
• Molecular Weight: 26kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 1700108N11Rik antibody, anti 1810007D21Rik antibody, anti M-OVO antibody, anti M-OVO-A antibody, anti M-OVO-B antibody, anti MOVO antibody, anti Ovo2 antibody, anti Zfp339 antibody, anti movo2 antibody

Quick Database Links

Gene Symbol

Ovol2

UniProt

Q8CIV7

RefSeq (Protein):NP_694455