OVOL2 antibody

• Catalog Number: orb324801
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OVOL2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IHC-P, WB
• Predicted Reactivity: Animal, Bovine, Canine, Human, Mouse
• Reactivity: Canine, Equine, Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OVOL2
• Concentration: 0.5 mg/ml
• Dilution range: WB: 0.2-1μg/ml, ELISA: 1-312500, IHC-P: 2.5μg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30 kDa
• Target: OVOL2
• UniProt ID: Q9BRP0
• Protein Sequence: Synthetic peptide located within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG
• NCBI: NP_067043
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EUROIMAGE566589 antibody, anti ZNF339 antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of 721_B cell lysate tissue using OVOL2 antibody

Immunofluorescense analysis of THP-1 Whole Cell using OVOL2 antibody