OVOL2 Rabbit Polyclonal Antibody

• Catalog Number: orb324801
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OVOL2
• Target: OVOL2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OVOL2
• Protein Sequence: Synthetic peptide located within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG
• UniProt ID: Q9BRP0
• MW: 30 kDa
• Tested applications: ELISA, IHC-P, WB
• Dilution range: WB: 0.2-1μg/ml, ELISA: 1-312500, IHC-P: 2.5μg/ml
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti EUROIMAGE566589 antibody, anti ZNF339 antibod
• Note: For research use only
• NCBI: NP_067043

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.

WB Suggested Anti-Ovol2 Antibody, Primary Dilution: 1:250 ug/mL, Positive Control: Human Corneal Endothelium.

WB Suggested Anti-OVOL2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.