OR1A1 Rabbit Polyclonal Antibody

• Catalog Number: orb55762
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OLR1514.
• Target: OR1A1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of rat OLR1514
• Protein Sequence: Synthetic peptide located within the following region: YFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRI
• UniProt ID: D3ZFE0
• MW: 35 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: OR17-7
• Research Area: Molecular Biology, Neuroscience, Signal Transducti
• Note: For research use only
• NCBI: NP_055380.2

Sample Tissue: Rat Muscle lysates, Antibody dilution: 1.0 ug/ml.