OR11A1 Rabbit Polyclonal Antibody

• Catalog Number: orb588810
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OR11A1
• Target: OR11A1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OR11A1
• Protein Sequence: Synthetic peptide located within the following region: YVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQALRKILCIK
• UniProt ID: Q9GZK7
• MW: 35 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: 6M1-18, OR11A2, hs6M1-18, dJ994E9.6
• Research Area: Epigenetics, GPCR, Neuroscience, Signaling Pathway
• Note: For research use only
• NCBI: NP_039225.1

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1.0 ug/ml.