NXF3 Rabbit Polyclonal Antibody

• Catalog Number: orb577814
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NXF3
• Target: NXF3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NXF3
• Protein Sequence: Synthetic peptide located within the following region: SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS
• UniProt ID: Q9H4D5
• MW: 58kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Research Area: Epigenetics & Chromatin, Molecular Biology, Protei
• Note: For research use only
• NCBI: NP_071335
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-NXF3 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-NXF3 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-NXF3 Antibody Titration: 1.25 ug/ml, Positive Control: RPMI 8226 cell lysate. NXF3 is supported by BioGPS gene expression data to be expressed in RPMI 8226.