NT5C3A Rabbit Polyclonal Antibody

SKU: orb589325

Description

Rabbit polyclonal antibody to NT5C3A

Research Area

Cell Biology, Epigenetics & Chromatin, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NT5C3
• Target: NT5C3A
• Protein Sequence: Synthetic peptide located within the following region: NVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNI
• Molecular Weight: 36 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

p36, PN-I, POMP, PSN1, UMPH, NT5C3, P5N-1, UMPH1, hUMP1, P5'N-1, cN-III

Sample Tissue: Human HeLa Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

NT5C3A

UniProt

Q9H0P0

RefSeq (Protein):NP_001002009.1