NRAS Rabbit Polyclonal Antibody

SKU: orb331222

Description

Rabbit polyclonal antibody to NRAS

Research Area

Neuroscience, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: NRAS
• Protein Sequence: Synthetic peptide located within the following region: ADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIP
• Molecular Weight: 21kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ALPS4 antibody, anti N-ras antibody, anti NRAS1 antibody, anti NS6 antibody

Rabbit Anti-NRAS Antibody, Catalog Number: orb331222, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-NRAS Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.

Quick Database Links

Gene Symbol

NRAS

UniProt

P01111

RefSeq (Protein):NP_002515