NR1I2 Rabbit Polyclonal Antibody

• Catalog Number: orb575750
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR1I2
• Target: NR1I2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2
• Protein Sequence: Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA
• UniProt ID: O75469
• MW: 50 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BXR, PAR, PRR, PXR, SAR, SXR, ONR1, PAR1, PAR2, PA
• Note: For research use only
• NCBI: NP_003880

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 5 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): MCF7 (N10), Antibody concentration: 0.3 ug/ml.

Immunohistochemistry with Human Small Intestine tissue at an antibody concentration of 5.0 ug/ml using anti-NR1I2 antibody (orb575750).

WB Suggested Anti-NR1I2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.

WB Suggested Anti-NR1I2 antibody Titration: 1 ug/ml, Sample Type: Human heart.