NR1I2 Rabbit Polyclonal Antibody

• Catalog Number: orb575749
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR1I2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: NR1I2
• UniProt ID: O75469
• Protein Sequence: Synthetic peptide located within the following region: EVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGY
• NCBI: NP_003880
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BXR, PAR, PRR, PXR, SAR, SXR, ONR1, PAR1, PAR2, PA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-NR1I2 Antibody, Catalog Number: orb575749, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclei in adipocytes but not in cardiomyocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-NR1I2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. NR1I2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

WB Suggested Anti-NR1I2 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-NR1I2 antibody Titration: 1 ug/ml, Sample Type: Human liver.