You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575749 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NR1I2 |
Target | NR1I2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I2 |
Protein Sequence | Synthetic peptide located within the following region: EVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGY |
UniProt ID | O75469 |
MW | 50kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BXR, PAR, PRR, PXR, SAR, SXR, ONR1, PAR1, PAR2, PA Read more... |
Note | For research use only |
NCBI | NP_003880 |
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-NR1I2 Antibody, Catalog Number: orb575749, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclei in adipocytes but not in cardiomyocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-NR1I2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. NR1I2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
WB Suggested Anti-NR1I2 antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB Suggested Anti-NR1I2 antibody Titration: 1 ug/ml, Sample Type: Human liver.
FC, IF, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Bovine, Equine, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |