Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NOX1 Rabbit Polyclonal Antibody

SKU: orb579887

Description

Rabbit polyclonal antibody to NOX1

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NOX1
TargetNOX1
Protein SequenceSynthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Molecular Weight65 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MOX1, NOH1, NOH-1, GP91-2

Similar Products

  • NOX1 Rabbit Polyclonal Antibody [orb247040]

    ELISA,  ICC,  IF,  IHC-P

    Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Nox1 Rabbit Polyclonal Antibody [orb6469]

    WB

    Bovine, Canine, Equine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NOX1 Antibody [orb676370]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Mox1 rabbit pAb Antibody [orb768407]

    IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • NOX1 Rabbit Polyclonal Antibody [orb629364]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NOX1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts were loaded per well using 12% SDS-PAGE. Membrane was incubated with 3 ug/ml of antibody.

NOX1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

NOX1 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

NOX1 Rabbit Polyclonal Antibody

NOX1 antibody - C-terminal region (orb579887) validated by WB using Epithelial Colorectal Adenocarcinoma CaCO2 at 1:10.

NOX1 Rabbit Polyclonal Antibody

WB Suggested Anti-NOX1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_008983

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

NOX1 Rabbit Polyclonal Antibody (orb579887)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry