NOX1 Rabbit Polyclonal Antibody

• Catalog Number: orb579887
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NOX1
• Target: NOX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NOX1
• Protein Sequence: Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
• UniProt ID: Q9Y5S8
• MW: 65 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MOX1, NOH1, NOH-1, GP91-2
• Note: For research use only
• NCBI: NP_008983

25 ug of the indicated Human whole cell extracts were loaded per well using 12% SDS-PAGE. Membrane was incubated with 3 ug/ml of antibody.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

NOX1 antibody - C-terminal region (orb579887) validated by WB using Epithelial Colorectal Adenocarcinoma CaCO2 at 1:10.

WB Suggested Anti-NOX1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.