NDP Rabbit Polyclonal Antibody

SKU: orb582991

Description

Rabbit polyclonal antibody to NDP

Research Area

Epigenetics & Chromatin, Neuroscience, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDP
• Target: NDP
• Protein Sequence: Synthetic peptide located within the following region: DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV
• Molecular Weight: 15kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ND, EVR2, FEVR

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5 ug/ml using anti-NDP antibody (orb582991).

WB Suggested Anti-NDP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

NDP

UniProt

Q00604

RefSeq (Protein):NP_000257