ND6 Rabbit Polyclonal Antibody

SKU: orb325568

Description

Rabbit polyclonal antibody to ND6

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Porcine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ND6
• Target: ND6
• Protein Sequence: Synthetic peptide located within the following region: DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT
• Molecular Weight: 19kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MTND6 antibody

Sample Tissue: Human DLD1 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/mL.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-ND6 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Lung.

Quick Database Links

Gene Symbol

ND6

UniProt

P03923

RefSeq (Protein):NP_536854