MPZ Rabbit Polyclonal Antibody

• Catalog Number: orb588926
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MPZ
• Target: MPZ
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPZ
• Protein Sequence: Synthetic peptide located within the following region: AALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKA
• UniProt ID: P25189
• MW: 28 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P0, CHM, DSS, MPP, CHN2, CMT1, CMT1B, CMT2I, CMT2J
• Research Area: Epigenetics, Neuroscience
• Note: For research use only
• NCBI: NP_000521.2

Sample Tissue: Human Liver Tumor, Antibody Dilution: 1.0 ug/ml.